DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and pyroxd1

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_957057.1 Gene:pyroxd1 / 393736 ZFINID:ZDB-GENE-040426-1732 Length:490 Species:Danio rerio


Alignment Length:390 Identity:77/390 - (19%)
Similarity:136/390 - (34%) Gaps:102/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 SSEDLPKHVPYLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWYTPNPNED 311
            ||....|.|.::|:|||.|..:....|.|...:.:|.::                   |.:|...
Zfish     4 SSMASEKQVKFVIVGGGIAGVTCAEQIASQFPSDEVCLL-------------------TASPLVK 49

  Fly   312 PIKDYRFKQWTGSERSLFFEPDEFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEI 376
            .:.::|....|..|    |:.:|   .|..:.:.....:.|.|. :|:.:.|::.::...||...
Zfish    50 KVTNFRQVSKTLEE----FDIEE---QPSRVLEEKYPNLKVLQS-AVRLLKAREHLLETEDGQRF 106

  Fly   377 SYDECLIATGCAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSEL- 440
            .|.:..:.:|..||.|.  :|.|     .|:..|..|.....:|..:..:.|.::|||.|..|| 
Zfish   107 FYRKLCLCSGGRPKLLS--KDNP-----HVLGIRDTDSAQEFQKRLSTAKRIVVIGNGGIALELV 164

  Fly   441 ----ACSLAHYSRENNGGKVY-----------QVFQENANMSKVLPNYLSRWTT----------- 479
                .|.:....::...|..:           .:..:....|.|...  :|:||           
Zfish   165 YEVEGCEVIWAVKDKAIGNTFFDAGAAQFLIPSLEADRREASSVCKR--ARYTTDSSAAGHSGSS 227

  Fly   480 -------------------AKMEAQGVCVIPNASIRSAVRDETNLK----------------LEL 509
                               ||...:||.:.....:......:..|:                ::|
Zfish   228 SELGSALGPDWHEGIELRGAKQSVRGVHIEYECEVEQIYTQQELLQSEHGTKTAELGVWPAYVQL 292

  Fly   510 NNGMTLMSDVVVVCVGCTPNTD--LAGPSRLEVDRSLGGFVVNAELEARRNLYVAGD-ASCFFDP 571
            .||.....|.:|...|..||||  |.| :..:|...||..|.:....:..:::.||| .|..::|
Zfish   293 TNGKIYGCDFIVSATGVVPNTDPFLPG-NNFDVAADLGLLVDDHMRTSEADVFAAGDVCSAGWEP 356

  Fly   572  571
            Zfish   357  356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 73/380 (19%)
Pyr_redox 427..512 CDD:278498 20/146 (14%)
AIF_C 591..720 CDD:291391
pyroxd1NP_957057.1 Pyr_redox_2 13..373 CDD:285266 73/381 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.