DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and Pyroxd1

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster


Alignment Length:406 Identity:85/406 - (20%)
Similarity:140/406 - (34%) Gaps:107/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 YLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWYTPNPNEDPIKDYRFKQW 321
            :|::|||.|..|...::......|.:|:::..        .:.|.:     .|..|:..|..|  
  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTES--------SIVKSV-----TNLVPVARYLHK-- 56

  Fly   322 TGSERSLFFEPDEFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECLIATG 386
                           .|..:.|.:..|.........:..:::::..:....|.||.|....:.||
  Fly    57 ---------------FDVREQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTG 106

  Fly   387 CAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELACSL------- 444
            ..||..     :...|...|:..|..|....|::..|..:.:.|:|||.|.||||..|       
  Fly   107 GTPKLF-----SGKVVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHW 166

  Fly   445 ----AHYSR---ENNGGKVYQVFQENAN--------------MSKVLPNYLSR---------WTT 479
                :|.|.   :....:.:.:.....|              .|:|||...:.         |..
  Fly   167 VVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHR 231

  Fly   480 A-------KMEAQGVCVIPNASIRSAVRDETN-----LKLELNNG--MTLMSDVVVVCVGCTPNT 530
            :       :.|...:..|...|..|:|:|..:     :|||..:|  ..|..|.:|...|..|||
  Fly   232 SVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNT 296

  Fly   531 DLAGPSRLEVDRSLGGFVVNAELEARRNL---YVAGD--------ASCFFDPLLGRRRVEHHDHS 584
            |....|.|:.... ||..|:..:  |.||   :.|||        |..:|...|..:..:     
  Fly   297 DYTCDSPLQFSDD-GGISVDEMM--RTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQ----- 353

  Fly   585 VVSGRLAGENMTGAKK 600
              .|.:||.:|..|.:
  Fly   354 --MGSMAGRSMAAASE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 79/377 (21%)
Pyr_redox 427..512 CDD:278498 27/133 (20%)
AIF_C 591..720 CDD:291391 4/10 (40%)
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 80/391 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.