DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and Pyroxd1

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001004234.1 Gene:Pyroxd1 / 297708 RGDID:1303253 Length:498 Species:Rattus norvegicus


Alignment Length:399 Identity:81/399 - (20%)
Similarity:131/399 - (32%) Gaps:133/399 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 YLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWYTPNPNEDPIKDYRFKQW 321
            ::::|||.|..:....:..|.....:|:::        ..|:.|.:             ..||| 
  Rat    10 FVVVGGGIAGVTCAEQLAINFPAEDILLVT--------ASPVIKAV-------------TNFKQ- 52

  Fly   322 TGSERSLFFEPDEFFID--PEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECLIA 384
              ..:.|    :||.::  |..:.:|....|.|.:. .||::.:.|..:...||.|..|.:..:.
  Rat    53 --VSKVL----EEFDVEEQPSTMLENRFPNIKVIES-GVKQLKSDKHCIFTEDGREYVYKKLCLC 110

  Fly   385 TGCAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELA-------- 441
            .|..||   ::.:..|.||.    .|..|.....:|...:.|.|.|||||.|..|||        
  Rat   111 AGAKPK---LICEGNPYVLG----IRDTDSAQEFQKQLTKARRIMIVGNGGIALELAYEVEVCEV 168

  Fly   442 --------------------------------CSLAH----YSREN------------------- 451
                                            ..|||    |:.|.                   
  Rat   169 IWAIKDKAIGNTFFDAGAAEFLTSRLLSEKSEAKLAHKRTIYTVEEAKKETSTKSKADYVGSALG 233

  Fly   452 ---NGG---KVYQVFQENANMS---KVLPNYLSRWTTAKMEAQGVCVIPNASIRSAVRDET--NL 505
               :||   |..:.|..:.::.   :|...||..  ..|:..:.....|....:|...|:.  .:
  Rat   234 PDWHGGLALKGTEEFSHSIHIETKCEVKKIYLQE--EFKIMKKKSLAFPKDHHKSVTVDKEMWPV 296

  Fly   506 KLELNNGMTLMSDVVVVCVGCTPNT---------DLAGPSRLEVDRSLGGFVVNAELEARRNLYV 561
            .:||.||.....|.:|...|.|||.         ||.....|.||..:        ..:..::|.
  Rat   297 YVELTNGSIYGCDFLVSATGVTPNVQPFLHGNDFDLGEDGGLRVDEQM--------RTSLPDIYA 353

  Fly   562 AGD--ASCF 568
            |||  .:|:
  Rat   354 AGDICTACW 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 81/399 (20%)
Pyr_redox 427..512 CDD:278498 28/158 (18%)
AIF_C 591..720 CDD:291391
Pyroxd1NP_001004234.1 Pyr_redox_2 <76..381 CDD:285266 65/305 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.