DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and Pyroxd1

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_898988.2 Gene:Pyroxd1 / 232491 MGIID:2676395 Length:498 Species:Mus musculus


Alignment Length:396 Identity:74/396 - (18%)
Similarity:135/396 - (34%) Gaps:127/396 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 YLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWYTPNPNEDPIKDYRFKQW 321
            ::::|||.|..:....:..:.....:|::                   |.:|....:.::|    
Mouse    10 FVVVGGGIAGVTCAEQLAVSFPEEDILLV-------------------TASPVIKAVTNFR---- 51

  Fly   322 TGSERSLFFEPDEFFID--PEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECLIA 384
               :.|...|  ||.::  |..:.::....|.|.:. .||::.::...:...||.|..|.:..:.
Mouse    52 ---QVSKVLE--EFDVEEQPGTMLESRFPNIKVIES-GVKQLKSEDHCIFTEDGREFVYKKLCLC 110

  Fly   385 TGCAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELA-----CSL 444
            .|..||   ::.:..|    :|:..|..|.....:|..|:.|.|.|||||.|..|||     |.:
Mouse   111 AGAKPK---LIYEGNP----RVLGIRDTDSAQEFQKELAKARRIMIVGNGGIALELAYEIEGCEV 168

  Fly   445 AHYSRENNGGKVYQVFQENANMSKVLPNYL---------------------SRWTTAKMEAQ--- 485
            ....::|..|..:    .:|..::.|.:.|                     .:.|..|.:|.   
Mouse   169 VWAIKDNAIGNTF----FDAGAAEFLTSKLMSEKSEAKIAHKRTIYTVEEAKKETRTKSKADYVG 229

  Fly   486 ---------GVCVIPNASIRSAVRDETNLK----------------------------------- 506
                     |:.:........:|..||..:                                   
Mouse   230 SALGPDWHGGLALKGTEEFSHSVHIETRCEVKKIYLEEEFKIMKKKSLAFPKDHHKSVTADKEMW 294

  Fly   507 ---LELNNGMTLMSDVVVVCVGCTPNTDLAGPSRLEVDRSL---GGFVVNAELE-ARRNLYVAGD 564
               :||.||.....|.:|...|.|||..   |.....:.:|   ||..|:.::. :..::|.|||
Mouse   295 PVYVELTNGTIYGCDFLVSATGVTPNVH---PFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGD 356

  Fly   565 --ASCF 568
              .:|:
Mouse   357 ICTACW 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 74/396 (19%)
Pyr_redox 427..512 CDD:278498 25/160 (16%)
AIF_C 591..720 CDD:291391
Pyroxd1NP_898988.2 Pyr_redox_2 <76..381 CDD:285266 61/302 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.