DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIF and AIFM3

DIOPT Version :9

Sequence 1:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001373743.1 Gene:AIFM3 / 150209 HGNCID:26398 Length:605 Species:Homo sapiens


Alignment Length:751 Identity:166/751 - (22%)
Similarity:239/751 - (31%) Gaps:263/751 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 CVTKPSTTPPVE-------------EYETAVEGAGVP-AYANAQFQAHSQSEPLFKVGFADVKSV 123
            |.:||.   |||             :.|.:..|.|.| ||.......|..:|             
Human     4 CFSKPK---PVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTE------------- 52

  Fly   124 CSAKDVLKSDSAKLSTSQPVLDSCKATSPCEEFKRKRKETTCQPCDEDGTAPGGGDGGDEECECR 188
                       .:|||..|.      .||             |.|.|...             |.
Human    53 -----------ERLSTPHPY------PSP-------------QDCVEAAV-------------CH 74

  Fly   189 MKDLRL-----------KCLL----GALAAL----------LAGGFLA-------W------FMT 215
            :|||..           |.||    |...||          |..|.|:       |      ..|
Human    75 VKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNIST 139

  Fly   216 RDTDD----SEAKKAEAEEEERK--------------RRLVAGLATSPPSSEDLPKHVPYLIIGG 262
            .|.:|    ....|.:.:.|:.|              |..|.....||.:......:|  ||:|.
Human   140 GDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNV--LIVGA 202

  Fly   263 GTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWYTPNPNEDPIKDYRFKQWTGSERS 327
            |.|.......::....:.::::.:.:...||.||.|||.|...|                   ..
Human   203 GAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQP-------------------EQ 248

  Fly   328 LFFEPDEFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECLIATGCAPKNL 392
            |...|.|||         ...||.|.....|..||.:.:.|...||:::.|.:.|:|.|.:||.|
Human   249 LALRPKEFF---------RAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSPKTL 304

  Fly   393 PMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELACSL---AHYSRENNGG 454
                ......:|.|...|||:|.:|:.:| |..|::.:||.||:|.|:|..|   ||        
Human   305 ----SCKGKEVENVFTIRTPEDANRVVRL-ARGRNVVVVGAGFLGMEVAAYLTEKAH-------- 356

  Fly   455 KVYQVFQENANMSKVLPNYLSRWTTAKMEAQGVCVIPNASIRSAVRDETNLK-LELNNGMTLMSD 518
            .|..|..|.....:.|...:.|......|...|.......:......|..|| :.|.:...:.:|
Human   357 SVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRAD 421

  Fly   519 VVVVCVGCTPNTDLAGPSRLEVDRSLGGFVVNAELEAR-RNLYVAGDASCFFDPLLGRR----RV 578
            |.||.:|..|.|.....|.:.:| |.|...||..::.. ..::.||||..|  ||..|.    .:
Human   422 VCVVGIGAVPATGFLRQSGIGLD-SRGFIPVNKMMQTNVPGVFAAGDAVTF--PLAWRNNRKVNI 483

  Fly   579 EHHDHSVVSGRLAGENMTGAKK-----PYQHQSMFWSDLGPEIGYEGIGLVDSSLPTVGVFALPS 638
            .|...:...||:|.:||...:.     ||...:||    |..:.|.|.|                
Human   484 PHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMF----GKSLRYAGYG---------------- 528

  Fly   639 ESATRVDQLSESSDSDVPETSTSSSQSSKSDAGASQDGVTCDPDEAGNYGKGVIFYLKNDKIVGI 703
                      |..|..:                     :..|.:|.    |.|.||.|.|:::.:
Human   529 ----------EGFDDVI---------------------IQGDLEEL----KFVAFYTKGDEVIAV 558

  Fly   704 LLWNLFNRIGLARTIINQNKKYDDLNEVAKLFEIHA 739
            ...|                 ||.:  |:|:.|:.|
Human   559 ASMN-----------------YDPI--VSKVAEVLA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 85/320 (27%)
Pyr_redox 427..512 CDD:278498 21/88 (24%)
AIF_C 591..720 CDD:291391 22/133 (17%)
AIFM3NP_001373743.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..45 6/22 (27%)
Rieske_AIFL_N 70..164 CDD:239560 20/106 (19%)
Pyr_redox_2 195..493 CDD:400379 89/343 (26%)
Reductase_C 512..>562 CDD:405449 17/104 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.