DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBCD and YHL008C

DIOPT Version :9

Sequence 1:NP_608648.1 Gene:TBCD / 33389 FlyBaseID:FBgn0027509 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_011855.1 Gene:YHL008C / 856381 SGDID:S000001000 Length:627 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:55/291 - (18%)
Similarity:97/291 - (33%) Gaps:79/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AYDTSTSAPTTNCSPVNHVQSKNTKMDR-IFELIQLYVSSNDTCSSMAAFLAAKYFIRSDIKDLY 224
            :|.|..|..:....|.:.:.|.|..|:. :.|.:|....||.|..|....|.........||.:.
Yeast   331 SYFTGRSLNSLRSIPSSVITSDNVTMESDLGEPVQFIPKSNSTTRSPHLGLPHNLPHNHSIKSIN 395

  Fly   225 LERFLDWIMEQH---------------------------------------QADTLNVKFGQLAA 250
            ..|    |.::|                                       :|:|.|        
Yeast   396 RHR----INKRHSLRSPPGVFPVRGMGEPLEREKTIEDATYDPKENELFLRRAETHN-------- 448

  Fly   251 VAAILKHGKREDLLPYADKLLQWITSCQYKDDNDFLKYKNYVKIIQRIG------LVHLKPRIAS 309
             :|.:|:.|:||     |.||:.:.:.:.::..::.|...|..:..:.|      :.||...::|
Yeast   449 -SAYVKNKKKED-----DNLLRLVKTEEDREQKEYEKNGGYNILENKPGTRLEKIITHLAENVSS 507

  Fly   310 WRYKRGTRSLATNLNQTT----AAGGEPVVLE--QSLEEGEEIVVPDAIEEVIEELLQALRSGGN 368
               :..|..:.....|.|    |....|...:  .||.:.....:......|.:|...:..:...
Yeast   508 ---REVTPPILPRTTQDTFPHNAPASSPAYTDDAHSLRKANSTTLGGLFRAVSKEFHSSKDAESP 569

  Fly   369 D--IRWSAAKGLGRVTNRLPKELADEVIGSV 397
            |  ::..||.|:    ||..:..|:.|.|.|
Yeast   570 DDLLKKMAAVGI----NRNARITANNVAGIV 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBCDNP_608648.1 TFCD_C 24..>584 CDD:303064 55/291 (19%)
HEAT repeat 355..383 CDD:293787 6/29 (21%)
HEAT repeat 393..423 CDD:293787 3/5 (60%)
TFCD_C 890..1075 CDD:289385
YHL008CNP_011855.1 FocA 3..269 CDD:225027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2116
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.