DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG42526

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:96/247 - (38%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NMSI--SYRNQ-DAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQKRIEMSHWPYFRS 83
            |:||  .|..: |....|.:|||..|:.|..|:.|:|.:||.|   ||:.|:.....|:...|:.
  Fly    15 NVSIFEKYHTRYDRKQAWIAVAQACQKSVEYCQIRWKSLRDRY---VRETQKPAATRSNIRKFKE 76

  Fly    84 LEFMRQIF----DPEGLVPFPPEPFVMNTEQPEVFEPTRLVD--FAIDLDLDNDDSVDFE----I 138
            |:|:|:..    .|..|..      .:||.:..|  |...||  .|.:|.|:.:...:|:    |
  Fly    77 LDFLREHIRIRRKPNELCN------TLNTNKTLV--PGVTVDSQSADELALERNGITEFQPDEFI 133

  Fly   139 IEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLSPTLPIHLPRHQQFLPRPPPPSKRG 203
            ||  :|.|.....::.:.....|....:.:.|:.                    ||....||..|
  Fly   134 IE--YKGEEEYLSETDNSSAEFISEDSACNIGSE--------------------LPYVTKPSFNG 176

  Fly   204 RRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAI 255
            ..:..:.:..:.::|...|.......||   .|....:|.|::..|...:.|
  Fly   177 EGQSQTQAKFMSVMNLIESALKDKPAEP---QDPFYKYLESILTGVDDSTRI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 25/71 (35%)
BESS 236..270 CDD:281011 5/20 (25%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.