DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and Adf1

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:302 Identity:53/302 - (17%)
Similarity:103/302 - (34%) Gaps:99/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIQEVSKRRCLWDTNMSISYRN-QDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQK 71
            ||:.|.....::|.: ..:|:: ...|..|..:|:.:......|.||:|.:||.:..|::..|:.
  Fly    16 LIEAVKLNPVIYDRS-HYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQES 79

  Fly    72 RIEMSHWPYFRSLEFM----------------------RQIFDPEGLVPFPPEPFVMNTEQPEVF 114
            |     |.||:.::|:                      .|:.||              ::|.:..
  Fly    80 R-----WRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADP--------------SQQQQAQ 125

  Fly   115 EPTRLVDFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLS 179
            :.|                     :.|||                 .:|.:.|   |..|.|.|:
  Fly   126 QQT---------------------VVDIF-----------------AQPFNGS---ATTSAQALT 149

  Fly   180 PTLPIHLPRHQQFL------PRP---PPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKN 235
            ....|.:....|..      .:|   .||.||.|..:....|.:..:..:.:..|::.:.     
  Fly   150 HPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQNNVSQAVSA----- 209

  Fly   236 DSDLSFLMSMMPHVKSLSAISNLKFRMEMARVLVELREEDQH 277
             .|.||.|.:...:.:|......:.::.:.:.|.:::...||
  Fly   210 -EDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 22/105 (21%)
BESS 236..270 CDD:281011 6/33 (18%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D98646at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.