DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG11504

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:442 Identity:90/442 - (20%)
Similarity:156/442 - (35%) Gaps:154/442 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQDAALQWAS-VAQIMQQDVSI--CKKRFKGMRDSYRAEVRKI 68
            :||.|...||.|||.... .||.:|...:..: |:|::..::.|  .:|:|..:|..|..|:.::
  Fly    10 QLISEYRSRRGLWDMTCD-EYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREISRM 73

  Fly    69 QQKRIEMSHWPYFRSLEFMRQIF-----------DPEGLVPFPPEPFV----------------- 105
            ::|....|.|..|::|.|:...:           |.:|    ....||                 
  Fly    74 KRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQG----DERKFVLGEVTADHNSDSSTPAN 134

  Fly   106 --------MNTE--------------QPEVFEPTRLVDFAIDLDLDNDD---------SVDFEII 139
                    ||.|              :..:.|.|:.||...:.:|:..:         ||.|..:
  Fly   135 HNSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVSL 199

  Fly   140 EDIFKREP------------------SVPQDSGSDKGSL---IKPLDSS-SSGAHRSDQDLSPTL 182
            .:..:.||                  .......::.|.|   ..|..|: ||..|     :.||.
  Fly   200 NEQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGSSSVH-----VMPTR 259

  Fly   183 PIHLPR--------------HQQFLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKSTT---E 230
            .|.:.|              |.|.   .|||.||              :...||.||.:||   .
  Fly   260 IIKIQRRDTSSGQEDSYFEEHTQL---HPPPVKR--------------MYYEASPASHNTTSILS 307

  Fly   231 PDLKNDSD--LSFLMSMMPHVKSLSAISNLKFRMEMARVLVELREEDQHMLAAAGPEDVLERSMP 293
            |.|::.::  .|.:::..|.:    .:|||:    :.:|....:......:.:..|..::  |:|
  Fly   308 PALESSANGTASSVLTTSPGI----TMSNLR----LPKVNTPPKPAQAQAIPSPPPPTIV--SLP 362

  Fly   294 KLTPAPNSSFATQLEKSQYHLSNSSYQISSRKTPTSFDY------VDSSMVE 339
               || ...|||..|    :::|....||:|:...:..:      .::||.|
  Fly   363 ---PA-RDEFATYGE----YVANEMRAISNREVLVALKHRINTAIFEASMAE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 25/86 (29%)
BESS 236..270 CDD:281011 6/35 (17%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 24/81 (30%)
CytochromB561_N 238..>409 CDD:286826 47/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.