DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and jigr1

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:320 Identity:73/320 - (22%)
Similarity:121/320 - (37%) Gaps:60/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIQEVSKRRCLWDTNMSISYRNQD---AALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQ 69
            ||:|......|:|.:   :.|.:|   .|..|..:|..:..|.:..::|...:|:.|..|.|:::
  Fly    33 LIREYRSHPVLYDRS---NKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVE 94

  Fly    70 Q-KRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLDLDND-- 131
            . ...:.|.||.|.||:|:..        ...|.....|....|..|.|..||   |...|::  
  Fly    95 NGLSTQSSQWPLFESLQFLGD--------HIRPRRSFKNMSVKEEDEETYEVD---DCRSDSNGH 148

  Fly   132 -DSVDFEIIED--IFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLSPTLP---------- 183
             :|:..|:.:|  ||..|.::|..:     .|..||::|.. |::|.:..:..:|          
  Fly   149 MNSIKDELEDDSEIFDCEQALPVTT-----VLGIPLNNSDE-ANKSQRSTNGEMPNGKGYNHFAE 207

  Fly   184 IHLPRHQQF--------LPRPPPPSKRGRRR-KTSPS----NDVPLLNGYASQASKSTTEPDLKN 235
            .:..|||..        :..|...:|||.:. ...||    :|...::||......:...|....
  Fly   208 SYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPTQPLAPLPPAYAK 272

  Fly   236 DSDLSFLMSM----MPHVKSLSAISNLKFRMEMARVLVELREEDQHMLAAAGPEDVLERS 291
            .......|..    ||...:|..:.  ||..|:  |...||.||..........|.:::|
  Fly   273 FRGFGEFMCHSLCDMPAATALRLVQ--KFTREL--VQSSLRNEDSGSKEKTDEVDPVDQS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 23/86 (27%)
BESS 236..270 CDD:281011 8/37 (22%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.