DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG12768

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:342 Identity:63/342 - (18%)
Similarity:117/342 - (34%) Gaps:115/342 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQD--AALQWASVAQIMQQDVSICKKRFKGMRDSYRAEV---R 66
            |||:.|.....|||..:. .|:..|  .|::|..:.::...:....::.|..:|:.:|.|:   :
  Fly    12 RLIELVRLNPILWDCRLP-HYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEK 75

  Fly    67 KIQQKRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLDLDND 131
            .:...|.: |.|.|:.::.|::::              :...:..|     |:...::|      
  Fly    76 MLGTTRFK-SKWEYYDAMAFLKEV--------------IRERKSRE-----RIKHGSLD------ 114

  Fly   132 DSVDFEIIEDIFKREPSVPQDSGSDKG-----SLIKPLDSSSSGAHRSDQDLSPTLPIHLPRHQQ 191
                            |.|..:||...     |.....::|||.|              |..:|.
  Fly   115 ----------------SAPVATGSSNNNNNCVSRNSSNNNSSSAA--------------LDEYQY 149

  Fly   192 FLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAIS 256
            |.|..|          .:|:|                 :|.|:            |..||...::
  Fly   150 FAPSDP----------NNPNN-----------------QPQLQ------------PEPKSSLPVT 175

  Fly   257 NLKFRMEMARVLVELREEDQHMLAAAGPEDV---------LERSMPKLTPAPNSSFATQLEKSQY 312
            .....:.::::.|.|:::.||:.|.....||         |..|:...||||.:..:.....|..
  Fly   176 IPSLSLTLSQLPVALQQQAQHLQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSS 240

  Fly   313 HLSNSSYQISSRKTPTS 329
            ...:||..|..:..|.|
  Fly   241 RSCSSSPSIYIKDEPCS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 20/88 (23%)
BESS 236..270 CDD:281011 3/33 (9%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.