powered by:
Protein Alignment CG11723 and CG6683
DIOPT Version :9
Sequence 1: | NP_001259906.1 |
Gene: | CG11723 / 33388 |
FlyBaseID: | FBgn0031391 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648232.1 |
Gene: | CG6683 / 38970 |
FlyBaseID: | FBgn0035902 |
Length: | 197 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 14/58 - (24%) |
Similarity: | 26/58 - (44%) |
Gaps: | 1/58 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 WASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQKRIEMSHWPYFRSLEFMRQIFDP 93
|:|:|..:..:.|.|..|:..:....|.|:.| ::.....|.|.....|:|::....|
Fly 39 WSSIATSLNSEASACVSRWNHLVAKQRRELAK-EKAGGTGSDWSLLPHLKFLQHHHHP 95
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11723 | NP_001259906.1 |
MADF |
7..91 |
CDD:214738 |
13/54 (24%) |
BESS |
236..270 |
CDD:281011 |
|
CG6683 | NP_648232.1 |
MADF |
7..94 |
CDD:214738 |
13/55 (24%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12243 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.