DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG9948

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster


Alignment Length:218 Identity:53/218 - (24%)
Similarity:80/218 - (36%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQDAALQ-WASVAQIMQQDVSICKKRFKGMRDSYRAEVRKI 68
            :::||..|.....|:..:...:|....|... ||.:|::|..||..|..|:..:...:|.|.|:.
  Fly    12 DFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRRA 76

  Fly    69 QQKRIEMSHWPYFRSLEFMRQIFDPEGLVPFP---PEPFVMNTEQPEVFEPTRLVDFAIDLDLDN 130
            ....   |.|||...|.|:.:|..|..:...|   .:...:.||.|        |.|..|...|.
  Fly    77 DTSG---STWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETP--------VQFLWDTFEDG 130

  Fly   131 D---DSVDFEIIEDIFKREPS--VPQD----SGSDKGSLIKPLDSSSSGAHRSDQDLSPTLPIHL 186
            |   .|..| |||::.: |||  :.|:    ...:...:|.|..|                  .|
  Fly   131 DVPQQSSTF-IIEEVIE-EPSEQIIQEEIIYEEQEPAEIISPRSS------------------FL 175

  Fly   187 PRHQQFLPRPPPPSKRGRRRKTS 209
            ...|.......|..:|..||.|:
  Fly   176 QMDQILAQLKEPQRRRAERRITA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 23/84 (27%)
BESS 236..270 CDD:281011
CG9948NP_001261492.1 MADF 14..95 CDD:214738 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.