DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and hng1

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:337 Identity:69/337 - (20%)
Similarity:128/337 - (37%) Gaps:99/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDNYR--------LIQEVSKRRCLWDTNM---SISYRNQDAALQWASVAQIMQQDVSICKKRFKG 56
            |.|:|        |||.:.:...|:|..:   .:|.|.::   .||.||.::...:|..::|:..
  Fly     2 SSNHRPLDDSDILLIQTIRETPSLYDPQLPSFRLSQRKEE---DWAKVADLLNISISDARRRWTC 63

  Fly    57 MRDSYRAEVRKIQQKRI----EMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFV------MNTEQP 111
            :||.|.   |:::|||:    |..|..:||.::|:|.              ||      ...|:.
  Fly    64 LRDRYS---RELKQKRLHPSGEFGHNDFFRKMDFLRD--------------FVRKRRERRGRERD 111

  Fly   112 EVFEPTRLVDFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAH---- 172
            ...:||..:  .:||.......:..: .|.:.:.:.|...|.|.::......|:|.::.:.    
  Fly   112 REQKPTGWM--KVDLQRRRRTRLPID-TETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSV 173

  Fly   173 --RSDQDLSP-------------------TLPIHLPR----HQQFLPRP-------------PPP 199
              .:|....|                   .:.|| |.    :....|.|             .||
  Fly   174 VVEADDGQEPEQESFDEFLGDAECEQKVKVVTIH-PEIAAPNATSAPEPIESNHADLNYLVCMPP 237

  Fly   200 SKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEM 264
            :....|..::|  ::|......:|.: ..||.|.       |..|:..:::.||.:..:|.::||
  Fly   238 NANQEREHSAP--ELPNPTAVITQKT-CETEDDF-------FCKSIAAYLRQLSRVHKIKAKVEM 292

  Fly   265 ARVLVE--LREE 274
            .::|.:  |.||
  Fly   293 YQILEKYILLEE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 27/98 (28%)
BESS 236..270 CDD:281011 8/33 (24%)
hng1NP_611558.2 MADF 15..98 CDD:214738 26/102 (25%)
BESS 264..298 CDD:281011 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.