DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG7745

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:462 Identity:79/462 - (17%)
Similarity:141/462 - (30%) Gaps:180/462 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLIQEVSKRRCLWDTNMSI--------SYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRA 63
            :||.||::...:::.....        .|..:|.|  |..:|..::.||..||||:|.:|:.|.:
  Fly     5 QLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEA--WQLIAMKLRTDVDTCKKRWKYLRERYVS 67

  Fly    64 EVRKIQQKRIEMSHWPYFRSLEFMRQIFDP----------------------------------- 93
            :.::......|....||...::|:.|...|                                   
  Fly    68 QRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSANSSGYNEYQVDKSNGSMK 132

  Fly    94 ----------EGLVPFPPEPFVMNT------------------EQPEVFEPTRLVDFAIDL---- 126
                      ..|...|.:...|:.                  |..:||.     |||..:    
  Fly   133 NVSQFGSSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEADQVFR-----DFAAAVASQQ 192

  Fly   127 ----------------------------DLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKP 163
                                        |...|.||.....::   ...|:...|.|.|..|..|
  Fly   193 LQHISQSQMQQQAAAVAAVMADSSQGYQDQYKDGSVGMNGAQN---SAGSLTSTSSSMKSPLSSP 254

  Fly   164 LDSSSSGAHRSDQDLSPTLPIHLPRHQQFLPRPPPPSKRGRRRKTSPSND--VPLLNGYASQASK 226
            |....:|:|...|...        :.||        .::.:.::.||:::  :|:::     :|.
  Fly   255 LQGIGAGSHHPQQQTQ--------QQQQ--------QQQQQAQQQSPASEQQLPVVH-----SSS 298

  Fly   227 STTEPDLKNDSDLSFLMSMM--PHVKSLSAISNLKFRMEMARVLV-------------------- 269
            |.|...:.|.|.|....|.:  |....|.:.|:..|.|:..|:.:                    
  Fly   299 SATGASIGNSSTLQMQQSHVYNPKGDGLDSSSSSHFHMKKPRIQLNGNAHNQMTSNGSHFGNDSD 363

  Fly   270 ELREEDQHML----AAAGPEDVLERSMP----------------KLTPAPNSSFATQLEKSQYHL 314
            :..:|:.|.|    |....|:....|||                ...|:.|:|...|.::...::
  Fly   364 DESDENSHDLMEPQAMMQQENHYSNSMPMQRGNGNGNNSSSNSGSNNPSGNNSHNNQQQQQHQNM 428

  Fly   315 --SNSSY 319
              ||:.:
  Fly   429 FPSNTDF 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 23/91 (25%)
BESS 236..270 CDD:281011 9/55 (16%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.