DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG10949

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:393 Identity:76/393 - (19%)
Similarity:144/393 - (36%) Gaps:95/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNYRLIQEVSKRRCLWDTNMSISYRN---QDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEV 65
            |:..||:.:.:...|:|.:.:.|.:|   :|||  |.:::|.:......|..|:|.:||.:..|.
  Fly     2 DDDELIKLIERHPILYDKDCARSVKNAAQKDAA--WKAISQKLGASERACITRWKSIRDRFGKEF 64

  Fly    66 RKIQQKRIEMSHWPYFRSLEFMRQIFDPEGL--------VPFPPEPFVMNTEQPEVFEPTRLVDF 122
            |:.|::..|.::|..|..|.|::..: .:||        :.|.|......|:.....|..|    
  Fly    65 RRFQERPDEPTYWDMFPRLLFLKDHY-KQGLARNESLDGMRFEPRERKKRTKVDMEQERRR---- 124

  Fly   123 AIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSS------------------ 169
               .|.:.:||.|..:.|.:.:...|.|......|..:.|.|.:.:.                  
  Fly   125 ---KDEEEEDSQDDLLNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYN 186

  Fly   170 ---------GAHRSDQDLSPTLPI---------HLPRH---------QQFLPRPPPPSKRGRRRK 207
                     |.......::.:.||         .|.||         :....|..||.......|
  Fly   187 RWKKLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGK 251

  Fly   208 TSPSNDVPLLNG----YASQASKSTTEPDLKNDSDLSF-----LMS----MMPH---VKSLSAIS 256
            ||...:..:::.    :.:....||...||::|.:|::     ::|    ..|:   :...:|..
  Fly   252 TSKQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQ 316

  Fly   257 NLK--FRMEMARVLVELREEDQHMLAAAGPEDVLERSMP-----------KLTPAPNSSFATQLE 308
            :|:  .::::........||..|.:|...|......|:|           ||.....::..|.|:
  Fly   317 DLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANMETVLQ 381

  Fly   309 KSQ 311
            :|:
  Fly   382 QSR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 24/86 (28%)
BESS 236..270 CDD:281011 6/47 (13%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738 24/88 (27%)
MADF 140..226 CDD:214738 11/85 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D98646at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.