DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and CG4404

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:316 Identity:63/316 - (19%)
Similarity:122/316 - (38%) Gaps:77/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVR--K 67
            |.|.:|.|..:.|||:.......:.:|....|..||..::..|..|::|::.:|.|:...::  :
  Fly    15 NVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLAR 79

  Fly    68 IQQKRIEMSHW---------PYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVF---EPTRLV 120
            .|..|.:..::         |:.:|....:|:   .|:|...|.......::.||.   |..::.
  Fly    80 TQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQL---PGMVLRKPGQAATAQQEDEVVAAEEEAKVS 141

  Fly   121 DFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPL---------DSSSS------- 169
            |..:.||:        ::.|:..:|.    |:...::.:...||         |||::       
  Fly   142 DGEMPLDV--------QVSEEEHRRN----QEQDREQPTACLPLRLHSIKVEHDSSNANQQLERM 194

  Fly   170 --------------GAHRSDQDLSPTLPIHLPRHQQF-----LPRPPPPSKRGRRRKTSPSNDVP 215
                          |.|....||:.....|...|.:.     .|..|||         .|.....
  Fly   195 VSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPTSPPP---------PPQPATS 250

  Fly   216 LLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEMARVLVEL 271
            .|:.:........::|    |:|.|||:|:.|::|.::...|.|||.::..::.::
  Fly   251 ALSVFTGGPGGGGSQP----DADYSFLISLHPYIKEMNGKQNRKFRQKVVGLIDDI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 20/94 (21%)
BESS 236..270 CDD:281011 12/33 (36%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/85 (21%)
BESS 267..301 CDD:281011 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.