DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11723 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:283 Identity:71/283 - (25%)
Similarity:110/283 - (38%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQDAALQ-WASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQ 70
            :|||.|.....|::.::. .||:.:..:: |..||..:...|..||:|:|.:||.|..|.|..:.
Zfish     8 KLIQTVYAFPVLYNVSLH-DYRSTERRVKAWREVAASVGLSVVECKRRWKTIRDRYIRERRLCKL 71

  Fly    71 KR----IEMSHWPYFRSLEFM----RQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLD 127
            |:    ..:.:||:..||.|:    |:...|.| ...|.|      ||.|......|.:   |.:
Zfish    72 KKDLGGRRLHYWPHRESLAFLDAHIRKRRRPSG-AQGPEE------EQQEEHSSAALQE---DKE 126

  Fly   128 LDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQ-----DLSPTLPIHLP 187
            ..:::.|                 ||||...  :.||..|...|....|     .:||.|...||
Zfish   127 CVSEECV-----------------DSGSRLA--VSPLPVSIMSAPPPPQLKAVPQVSPLLLAALP 172

  Fly   188 RHQQFLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSL 252
               ..|...|..|.........|.| |||         :.....|...|.|..||:|.:|.:|.|
Zfish   173 ---PGLKVAPVCSSATGSASAGPLN-VPL---------EEQQRADGALDEDQLFLLSYVPALKRL 224

  Fly   253 SAISNLKFRMEMARVL--VELRE 273
            :.......:|::.:::  .|.:|
Zfish   225 TPQKRAAVKMQIQQIMFNAEFKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 27/92 (29%)
BESS 236..270 CDD:281011 9/35 (26%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 26/89 (29%)
BESS 208..242 CDD:281011 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.