DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and prss60.1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:236 Identity:72/236 - (30%)
Similarity:105/236 - (44%) Gaps:30/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDL 102
            ::||.|| |....:...:.| |||||...||||||.|...|...|:|..|:    ||  ||.|:.
Zfish    44 SWPWQVS-LHSPIYGGHFCG-GSLINSEWVLTAAHCLPRITTSSLLVFLGK----TT--QQGVNT 100

  Fly   103 EVLN-----IVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGK 161
            ..:|     |..|..:|....||::|||.|.||...:..|..:.|..|.:....| |.:..|||.
Zfish   101 YEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGN 165

  Fly   162 VYLN-STDYPTVLKTVQVDLLSMGMCS----SRKLPIQQICGKGLEG--IDCSGDGGAPLV---C 216
            :.|. :...|.:|:...:.::....|:    |..:....||...|:|  ..|.||.|.|:|   |
Zfish   166 IQLGVNLPAPGILQETMIPVVPNDQCNALLGSGSVTNNMICAGLLQGGRDTCQGDSGGPMVSKQC 230

  Fly   217 RILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWID 257
            .:      :.|.||.:|........:..|:|.|:....||:
Zfish   231 LV------WVQSGITSWGYGCADPYSPGVYTRVSQYQSWIN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 72/235 (31%)
Tryp_SPc 39..256 CDD:214473 70/232 (30%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 70/233 (30%)
Tryp_SPc 34..267 CDD:238113 72/236 (31%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.