DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and gzma

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:289 Identity:65/289 - (22%)
Similarity:111/289 - (38%) Gaps:74/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYFAFLTTLI---ISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLINP 64
            |.|.|....:   :|:|.              |.:.:....|:||:...::   ...| |.||:.
Zfish    13 LVFTFFKVTVCSDVSIVG--------------GKDVKKALSWMVSIQVNQN---HKCG-GILIHK 59

  Fly    65 NVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVS 129
            ..||||||....:.. .:.|..|....|..:.:    :.:.|....|.||:...::::.|:.|  
Zfish    60 EWVLTAAHCKEDSYS-SVTVLIGSLSLSKGSQR----IAIHNYEIPETFNKKTKKDDIMLIRL-- 117

  Fly   130 AFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYLNSTDYP--------TVLKTVQVDLLSMGM 185
            :.::.|....||  .:|..:|.|: |...|||     :|||.        .:|:.:.||.:....
Zfish   118 SKKVKAKPYKIP--KKEKDVQPGTKCVVRGWG-----TTDYKGKQASDKLQMLEVLVVDRVQCNR 175

  Fly   186 CSSRKLPI---QQICGKGLE---GIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLS--------Q 236
            ..:|. |:   ..:|....:   | .|.||.|.||.|          :..:|..||        :
Zfish   176 YYNRN-PVITKDMLCAGNTQQHRG-TCLGDSGGPLEC----------EKNLVGVLSGSHGCGDPK 228

  Fly   237 KPVENTFIVFTNVAGLLPWIDYHLRLEAN 265
            ||...|.:...::.    ||:..|:.:.|
Zfish   229 KPTVYTLLSKRHIT----WINKILKQQFN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 57/242 (24%)
Tryp_SPc 39..256 CDD:214473 55/239 (23%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 59/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.