DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss41

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:296 Identity:77/296 - (26%)
Similarity:120/296 - (40%) Gaps:58/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AFLTTLIISLVNSQYFNYNQIRRETYG--SNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVL 68
            |.|.:..|.|::......|..|....|  .:.:..:||..|:..::.   ...| |||::...||
Mouse    60 ADLKSTDIKLLSMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKS---HRCG-GSLLSRRWVL 120

  Fly    69 TAAHILNGTTKY-----------DLVVRAGEWDTSTTADQQHVDLEVLN----IVSHEQFNRFNA 118
            ||||...   ||           .|..:...|:....:.:..|...::|    :.||:       
Mouse   121 TAAHCFR---KYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSHD------- 175

  Fly   119 ENNMALLILVSAFEMTANINLIPLYLQEAGI---QKGSCFFNGWGKVY--LNSTDYPTVLKTVQV 178
               :|||.|.|:  :|.|.::.|:.:|.:..   .:..|:..|||.:.  |.....|..|:.|||
Mouse   176 ---LALLRLASS--VTYNKDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQV 235

  Fly   179 DLLSMGMC-------SSRKLPIQQICGKGLE---GIDCSGDGGAPLVCRI--LTYPYKYAQVGIV 231
            .:|:...|       |...|..:.:...|.|   ...||||.|.||||.:  |.|     |:|||
Mouse   236 SILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWY-----QIGIV 295

  Fly   232 NWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEANFR 267
            :|.......|...::|||:....||:..:.|....|
Mouse   296 SWGIGCGRPNLPGIYTNVSHYYNWIETMMILNGAVR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/251 (27%)
Tryp_SPc 39..256 CDD:214473 66/248 (27%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.