DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Klk12

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:242 Identity:67/242 - (27%)
Similarity:100/242 - (41%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLF--RYIGVGS-LINPNVVLTAAHILNGTTKYDLVVRAGE-------WDTSTT 94
            ||.|.       ||  :|:..|. |::...||||||..:   ||  |||.||       |    |
Mouse    34 PWQVG-------LFHGKYLRCGGVLVDRKWVLTAAHCRD---KY--VVRLGEHSLTKLDW----T 82

  Fly    95 ADQQHVDLEVLNIVSHEQFNRF--NAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFF 156
            ...:|....    ::|..:...  |.|:::.||.|.....:|..:.  |:.|..:.:..|: |..
Mouse    83 EQLRHTTFS----ITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAVR--PVALPSSCVTTGAMCHV 141

  Fly   157 NGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSS---RKLPIQQICGKGLEGID-CSGDGGAPLVC- 216
            :|||........:|..|:.:.:..:|...|.:   .::....:|..|..|.| |.||.|.|||| 
Mouse   142 SGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVTENMLCAGGEAGKDACQGDSGGPLVCG 206

  Fly   217 RILTYPYKYAQVGIVNWLSQKPVENTFI--VFTNVAGLLPWIDYHLR 261
            .:|.        |:|:|.|..|.....|  |:|.|.....||...:|
Mouse   207 GVLQ--------GLVSWGSVGPCGQKGIPGVYTKVCKYTDWIRIVIR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 66/238 (28%)
Tryp_SPc 39..256 CDD:214473 64/235 (27%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.