DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Ctrb1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:237 Identity:76/237 - (32%)
Similarity:118/237 - (49%) Gaps:26/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVD- 101
            ::||.||:.|:..  |.:.| ||||:.|.|:||||.  |....|:|| |||:|..  :|:::|. 
Mouse    44 SWPWQVSLQDRTG--FHFCG-GSLISENWVVTAAHC--GVKTTDVVV-AGEFDQG--SDEENVQV 100

  Fly   102 LEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYLN 165
            |::..:..:.:||.|...|::.||.|.:..:.:..::.:.|...:.....|: |...||||...|
Mouse   101 LKIAQVFKNPKFNSFTVRNDITLLKLATPAQFSETVSAVCLPTVDDDFPAGTLCATTGWGKTKYN 165

  Fly   166 STDYPTVLKTVQVDLLSMGMCS---SRKLPIQQICGKGLEGI-DCSGDGGAPLVCRILTYPYK-- 224
            :...|..|:...:.::|...|.   ..|:....||. |..|: .|.||.|.||||:      |  
Mouse   166 ALKTPDKLQQAALPIVSEAKCKESWGSKITDVMICA-GASGVSSCMGDSGGPLVCQ------KDG 223

  Fly   225 -YAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEAN 265
             :...|||:|.|.....:|..|:..|..|:||:..  .||||
Mouse   224 VWTLAGIVSWGSGFCSTSTPAVYARVTALMPWVQE--ILEAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 72/228 (32%)
Tryp_SPc 39..256 CDD:214473 71/225 (32%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 71/226 (31%)
Tryp_SPc 34..259 CDD:238113 72/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.