DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:271 Identity:71/271 - (26%)
Similarity:125/271 - (46%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GSNPRA-TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILN---GTTKYDLVVRAGEWDTS 92
            |.|..| ::||.|| |....:...:.| |||||.:.||:|||...   ||    ::|:.| ..:.
Zfish    39 GQNAGAGSWPWQVS-LQSPTYGGHFCG-GSLINKDWVLSAAHCFQDSIGT----IMVKLG-LQSQ 96

  Fly    93 TTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS---C 154
            :.::...:...|:.:::|..:|..:.:|::||:.|.|:  :|.|..:.|:.|..||....:   .
Zfish    97 SGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSS--VTFNDYIEPVCLAAAGNTYAAGTLS 159

  Fly   155 FFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR---KLPIQQICGKGLE--GID-CSGDGGAP 213
            :..||||:...:...|.:|:.|::.::|...|...   ::....||...|:  |.| |.||.|.|
Zfish   160 WVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGP 224

  Fly   214 LVCR---------ILT---------YPYKYAQVG-IVNWLSQKPVENTFIVFTNVAGLLPWIDYH 259
            :|.|         |::         ||..||:|. ..:|::.....      :|..|   ::::|
Zfish   225 MVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSSTGS------SNPPG---FVEFH 280

  Fly   260 LRLEANFRPRS 270
               .:.||..|
Zfish   281 ---SSGFRSTS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/250 (26%)
Tryp_SPc 39..256 CDD:214473 64/247 (26%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 64/233 (27%)
Tryp_SPc 36..264 CDD:238113 64/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.