DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG34436

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:235 Identity:60/235 - (25%)
Similarity:100/235 - (42%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHV---- 100
            ||:..||     |......|:||:...|:|:|..:....:  .:||.|:    .:..|:|:    
  Fly    42 PWMALVL-----LPNKTCSGALIHKYFVITSASCVFNQER--AIVRLGQ----LSIKQEHIVSYS 95

  Fly   101 --DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI-----QKGSCFFNG 158
              |..|.:...|..:.:.|.|:::|||.|.:.....|:|..|.|:|.::.|     ::...|  .
  Fly    96 SDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIRPICLWLDKSDIDTQMFKRYETF--R 158

  Fly   159 WGKVYLNSTDYPTVL---KTVQVDLLSMGMCSSR-KLPIQ--QICGKGLEGIDCSGDGGAPLVCR 217
            ||      .|...:|   ||.::..:|...|.:. ||..|  .||. |.:......:.|:||..:
  Fly   159 WG------IDEKYILPAAKTSKIKHISQVKCENAFKLYPQNSHICA-GYKNKSKCVETGSPLFKK 216

  Fly   218 ILTY-PYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            |..| ..:|...||     |...|:...::|:|...:.||
  Fly   217 IRYYTKIRYTLFGI-----QSYGESRTCLYTDVTKYIDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 60/235 (26%)
Tryp_SPc 39..256 CDD:214473 58/233 (25%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 60/235 (26%)
Tryp_SPc 40..251 CDD:214473 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.