DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG34437

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:265 Identity:60/265 - (22%)
Similarity:108/265 - (40%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLTTLIISLVNSQYF---------NYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLI 62
            ||.||:::...|.||         .:..:.:||         ||:..:.......     .|:||
  Fly     8 FLFTLVLAHQGSAYFLDFECVNHKPHQDVFKET---------PWMAFIASPTKNC-----SGTLI 58

  Fly    63 NPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLIL 127
            |...|:|.|..:  ..:.:..|..|.:|.......::|...|.::.:|:.:|:...|:::|||:|
  Fly    59 NKQYVITTASCV--FDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLL 121

  Fly   128 VSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR--- 189
            ........:|..|.::|.|. ........|.||   |:.......:.||::  |.:..|...   
  Fly   122 DDPVTFKMSIQPICIWLGEI-TNLNHLESNRWG---LSEKMIFQRINTVKI--LKIKKCRDSFGI 180

  Fly   190 KLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKY--AQVGIVNW-LSQKPVENTFIVFTNVAG 251
            .|...|||.....|..|: :.|:.||.:| .|..|.  ..:||.:: :|::      .::..:|.
  Fly   181 TLKKSQICAGFQNGNICT-ETGSSLVKQI-HYSGKLWNTLIGIQSYGVSER------CIYNKIAH 237

  Fly   252 LLPWI 256
            .:.||
  Fly   238 YIDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 51/224 (23%)
Tryp_SPc 39..256 CDD:214473 49/222 (22%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 51/232 (22%)
Tryp_SPc 39..242 CDD:304450 51/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.