DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and tmprss5

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:232 Identity:66/232 - (28%)
Similarity:108/232 - (46%) Gaps:24/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDL------VVRAGEWDTSTTADQ 97
            :||.||:....    |:|..||:|....::||||.::   .|.|      ||.||...::.....
Zfish   323 WPWQVSLYYNN----RHICGGSIITNQWIVTAAHCVH---NYRLPQVPSWVVYAGIITSNLAKLA 380

  Fly    98 QHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGK 161
            |:....|..|:.::.:|....:|::||:.|.:....:..|..:.|...:..:..|: |:.:|||.
Zfish   381 QYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGY 445

  Fly   162 VYLNSTDYPTVLKTVQVDLLSMGMCSSR-----KLPIQQICGKGLEG-ID-CSGDGGAPLVCRIL 219
            ...:....|.|||...|.|:|...|:|.     ::..:.:|....|| :| |.||.|.||||:..
Zfish   446 TQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDE 510

  Fly   220 TYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            ..   :..||:|:|.:.....|...|::.||..|.||
Zfish   511 NV---WRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 66/232 (28%)
Tryp_SPc 39..256 CDD:214473 64/230 (28%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 64/230 (28%)
Tryp_SPc 312..547 CDD:238113 66/232 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.