DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP001247

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001689376.2 Gene:AgaP_AGAP001247 / 5667666 VectorBaseID:AGAP001247 Length:253 Species:Anopheles gambiae


Alignment Length:208 Identity:50/208 - (24%)
Similarity:91/208 - (43%) Gaps:15/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMAL 124
            |:::.::.:||||.|......:.:...| ..|:.|.....|....:.::.|..:|.....|::||
Mosquito    45 SVVDASLAITAAHCLTPKPPPEFITLMG-GSTNRTDYDVGVIFNAIELIIHPGYNSNTFHNDVAL 108

  Fly   125 LILVSAFEMTANINLIPLYLQEAGIQKGS---CFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC 186
            :.:...|....|:..|||..:.......:   |..:|||...:|....|.:|:.|::.|:....|
Mosquito   109 VRIEGTFGGYENVAPIPLRTRTIFTSSSNPVYCTVSGWGLTNMNGDGLPEILRIVRIPLVPYTEC 173

  Fly   187 SSRKLPI----QQICGKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFT 247
            ..:..|.    ..||...|....|:||.|.||||....|       |||:|.|.:...:...::|
Mosquito   174 RRKWNPFPITSSMICAGELRKDACNGDSGGPLVCNGQLY-------GIVSWGSNQCGSSYPGIYT 231

  Fly   248 NVAGLLPWIDYHL 260
            ::..:|.::..::
Mosquito   232 SIPAVLSFLSEYM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 50/205 (24%)
Tryp_SPc 39..256 CDD:214473 50/202 (25%)
AgaP_AGAP001247XP_001689376.2 Tryp_SPc 16..238 CDD:214473 49/200 (25%)
Tryp_SPc 17..242 CDD:238113 50/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.