Sequence 1: | NP_001259904.1 | Gene: | CG4259 / 33385 | FlyBaseID: | FBgn0031389 | Length: | 270 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011516267.1 | Gene: | PRSS3 / 5646 | HGNCID: | 9486 | Length: | 333 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 58/206 - (28%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 24/206 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 GSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMA 123
Fly 124 LLILVSAFEMTANINLI--PLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC 186
Fly 187 SSR---KLPIQQICGKGLEG--IDCSGDGGAPLVCRILTYPYKYAQV-GIVNWLSQKPVENTFIV 245
Fly 246 FTNVAGLLPWI 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4259 | NP_001259904.1 | Tryp_SPc | 39..259 | CDD:238113 | 58/206 (28%) |
Tryp_SPc | 39..256 | CDD:214473 | 56/204 (27%) | ||
PRSS3 | XP_011516267.1 | Tryp_SPc | 109..325 | CDD:214473 | 56/204 (27%) |
Tryp_SPc | 110..328 | CDD:238113 | 58/206 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |