DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and tmprss13a

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001152984.1 Gene:tmprss13a / 559754 ZFINID:ZDB-GENE-090309-3 Length:506 Species:Danio rerio


Alignment Length:239 Identity:67/239 - (28%)
Similarity:110/239 - (46%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNG---TTKYDLVVRAGEWDTSTTADQQHV 100
            :||.||:...:    .::..|:||:|:.:::|||...|   .:.|.||...       ...||.:
Zfish   280 YPWQVSLHYNK----AHVCGGTLISPDFIVSAAHCFQGKMANSAYWLVYVG-------IVSQQSL 333

  Fly   101 DLEVL--NIVSHEQFNRFNAENNMALLILVS--AFEMTANINLIPLYLQ--EAGIQKGSCFFNGW 159
            .:..|  .|:..|::|....:|::|||||..  ||..|.....:|.:.|  ..|:|   |:.:|:
Zfish   334 GMPYLVKKIIVSEKYNSDTNDNDVALLILSRPVAFSYTTQPVCLPTFNQTFSGGLQ---CWTSGF 395

  Fly   160 GKVYLNSTDYPTVLKTVQVDLLSMGMCSSRK-----LPIQQICGKGLEG--IDCSGDGGAPLVCR 217
            |.....:....:.|.:|.|:::...:|:|.:     :....||...|:|  ..|.||.|.||||:
Zfish   396 GTTKQGADRASSSLMSVSVNIIDSSVCNSCQIYCGLITNNMICAGDLKGGRDSCQGDSGGPLVCK 460

  Fly   218 ILTYPYKYAQVGIVNW-----LSQKPVENTFIVFTNVAGLLPWI 256
              ....::..|||.:|     ..|||.     |::.|...||||
Zfish   461 --DDNNRWYLVGITSWGAGCGQKQKPG-----VYSRVTSFLPWI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 67/239 (28%)
Tryp_SPc 39..256 CDD:214473 65/237 (27%)
tmprss13aNP_001152984.1 SRCR_2 178..261 CDD:295335
Tryp_SPc 268..497 CDD:214473 65/237 (27%)
Tryp_SPc 269..497 CDD:238113 65/237 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.