DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and KLK15

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:244 Identity:64/244 - (26%)
Similarity:99/244 - (40%) Gaps:55/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTK-----YDLVVRAGEWDTSTTADQQH 99
            ||.|::.::.    |:....|||:|:.||:|||..:...:     ::|..|.|.....||:    
Human    34 PWQVALYERG----RFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTS---- 90

  Fly   100 VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANIN--LIPLYLQEAGIQKGSCFFNGWGKV 162
                  .::.|.::...:..|::.||.||....:...:.  ::|......|   .:|..:|||.|
Human    91 ------RVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPG---EACVVSGWGLV 146

  Fly   163 YLN----------STDYPTVLKTVQVDLLSMGMCSSR---KLPIQQIC----GKGLEGIDCSGDG 210
            ..|          ....|..|....:.::|...|...   :|....:|    |:|.|  .|.||.
Human   147 SHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAE--SCEGDS 209

  Fly   211 GAPLVC-RILTYPYKYAQVGIVNWLSQKPVENTFI--VFTNVAGLLPWI 256
            |.|||| .||.        |||:| ...|.:||..  |:|.|...|.||
Human   210 GGPLVCGGILQ--------GIVSW-GDVPCDNTTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/244 (26%)
Tryp_SPc 39..256 CDD:214473 62/242 (26%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.