DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:232 Identity:62/232 - (26%)
Similarity:104/232 - (44%) Gaps:16/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TFPWVVSV--LDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHV 100
            ::||..|:  :...|    :|..|||||.:.||:|||....|...::.:..|. ...|.::...:
Zfish    45 SWPWQASIHRISPED----HICGGSLINKDWVLSAAHCFMITATANIKIFLGR-QFQTGSNPNEI 104

  Fly   101 DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYL 164
            ...:..||.|..::.....|::|||.|.|:...|..|..:.|...::....|: .:..||.|...
Zfish   105 SRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSWITGWDKHRS 169

  Fly   165 NSTDYPTVLKTVQVDLLSMGMCSSRKLPI---QQIC-GKGLEGID-CSGDGGAPLVCRILTYPYK 224
            :......||:.||:.::|...|::....|   ..|| |....|.| |.||.|.|:|.:   ...:
Zfish   170 SDIQVTNVLQEVQLPVVSNTECNADYKGIITDNMICAGINEGGKDACQGDSGGPMVSQ---NGSR 231

  Fly   225 YAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            :.|.|||::..:..:.....::|.|:....||...||
Zfish   232 WIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 60/227 (26%)
Tryp_SPc 39..256 CDD:214473 58/224 (26%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 58/225 (26%)
Tryp_SPc 37..263 CDD:238113 58/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.