DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tpsab1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:233 Identity:68/233 - (29%)
Similarity:103/233 - (44%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLE 103
            :||.||:.....:...:.| ||||:|..||||||.: |..|.|......:..........|: |.
  Rat    77 WPWQVSLRVNDTYWMHFCG-GSLIHPQWVLTAAHCV-GPNKADPNKLRVQLRKQYLYYHDHL-LT 138

  Fly   104 VLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYLN-S 166
            |..|:||..|.......::|||.|.:...:|:|::.:.|.........|: |:..|||.:..: |
  Rat   139 VSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVS 203

  Fly   167 TDYPTVLKTVQVDLLSMGMCSSRK------------LPIQQICGKGLEGID-CSGDGGAPLVCRI 218
            ...|..|:.|||.::...:|..:.            :....:|. |.||.| |.||.|.||||::
  Rat   204 LPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCA-GNEGHDSCQGDSGGPLVCKV 267

  Fly   219 LTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
               ...:.|.|:|:|.......|...::|.|...|.||
  Rat   268 ---EDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/233 (29%)
Tryp_SPc 39..256 CDD:214473 66/231 (29%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 66/231 (29%)
Tryp_SPc 66..302 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.