DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and prss60.2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:233 Identity:72/233 - (30%)
Similarity:103/233 - (44%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIG---VGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTAD 96
            |..::||.||:...     ||.|   .||||:...||||||.|.|.::..|||..|. .|....:
Zfish    41 PEGSWPWQVSLQSP-----RYGGHFCGGSLISSEWVLTAAHCLPGVSESSLVVYLGR-RTQQGVN 99

  Fly    97 QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWG 160
            .......|..|:.|..:|....:|::|||.|.||......|..:.|..|.:....| |.:..|||
Zfish   100 THETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWG 164

  Fly   161 KVYLN-STDYPTVLKTVQVDLLSMGMCS----SRKLPIQQIC-GKGLEGID-CSGDGGAPLVCRI 218
            .|... :...|.:|:...:.:::...|:    |..:....|| |....|.| |.||.|.|:|.|:
Zfish   165 DVQAGVNLPAPGILQETMIPVVANDRCNAQLGSGTVTNNMICAGLAKGGKDTCQGDSGGPMVTRL 229

  Fly   219 LTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            .|.   :.|.||.:|.......|:..|:|.|:....||
Zfish   230 CTV---WIQAGITSWGYGCADPNSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 71/229 (31%)
Tryp_SPc 39..256 CDD:214473 69/227 (30%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 70/231 (30%)
Tryp_SPc 34..267 CDD:238113 72/233 (31%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.