DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CELA2B

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_056933.3 Gene:CELA2B / 51032 HGNCID:29995 Length:269 Species:Homo sapiens


Alignment Length:270 Identity:72/270 - (26%)
Similarity:122/270 - (45%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTTLIISLVNSQYFNY-NQIRRETYGSNPRA-TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTA 70
            |:||:...::.....| ..:.|...|...|. ::||.||:....:..:.:...||||..:.||||
Human     7 LSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGGSLIANSWVLTA 71

  Fly    71 AHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFN--RFNAENNMALLILVSAFEM 133
            ||.::.:..|.:::  |:.:. ..|:...:.:.|..||.|:.:|  :.:..|::|||.|.:...:
Human    72 AHCISSSGIYRVML--GQHNL-YVAESGSLAVSVSKIVVHKDWNSDQVSKGNDIALLKLANPVSL 133

  Fly   134 TANINLIPLYLQEAGI---QKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSS-----RK 190
            |..|.|  ..|..||.   ....|:..|||::..|.. .|..||..|:.::....|||     ..
Human   134 TDKIQL--ACLPPAGTILPNNYPCYVTGWGRLQTNGA-LPDDLKQGQLLVVDYATCSSSGWWGST 195

  Fly   191 LPIQQICGKGLEGI--DCSGDGGAPLVCRILTYPYKYAQVGIV------NWLSQKPVENTFIVFT 247
            :....||..| :|:  .|:||.|.||.|:.....::...:|.:      |:. .||     .:||
Human   196 VKTNMICAGG-DGVICTCNGDSGGPLNCQASDGRWEVHGIGSLTSVLGCNYY-YKP-----SIFT 253

  Fly   248 NVAGLLPWID 257
            .|:....||:
Human   254 RVSNYNDWIN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 65/237 (27%)
Tryp_SPc 39..256 CDD:214473 63/234 (27%)
CELA2BNP_056933.3 Tryp_SPc 31..265 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.