DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss44

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:214 Identity:64/214 - (29%)
Similarity:107/214 - (50%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH 99
            |...:||.||:...:    ::|..||||:...|:||||.:.|  ..|.||..||.|..::   ..
  Rat   120 PIRKWPWQVSLQVHK----QHICGGSLISKWWVMTAAHCVYG--HLDYVVSMGEADLWSS---MS 175

  Fly   100 VDLEVLNIVSHEQFNRFNA-ENNMALLILVSAFEMTANINLIPLYLQEAG--IQKGS-CFFNGWG 160
            |.:.|.:|:.|:.::.... .:::||::|  ||.:..::|:.|:.:.|..  :|.|: |:..|||
  Rat   176 VKIPVQDIIVHQDYSVMRTIVHDIALVLL--AFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWG 238

  Fly   161 KVYLNSTDYPTVLKTVQVDLLSMGMC-------SSRKLPIQQ---ICGKGLEGID-CSGDGGAPL 214
            |. :.......||:.|.:.::....|       :.|...:.|   :||...:|.| |.||.|.|:
  Rat   239 KT-IERGRSSRVLREVDLSIIRHERCNQILKDITGRIFTLVQEGGVCGYNKKGGDACQGDSGGPM 302

  Fly   215 VCRILTYPYKYAQVGIVNW 233
            ||.   :...:.|||||:|
  Rat   303 VCE---FNKTWVQVGIVSW 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 63/210 (30%)
Tryp_SPc 39..256 CDD:214473 63/210 (30%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 64/214 (30%)
Tryp_SPc 113..341 CDD:238113 64/214 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.