DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPE7

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001238368.1 Gene:CLIPE7 / 4577639 VectorBaseID:AGAP011786 Length:433 Species:Anopheles gambiae


Alignment Length:255 Identity:82/255 - (32%)
Similarity:117/255 - (45%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RETYGSNPRAT-FPWVVSVLDQRDW--LFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEW 89
            |..:|....|| |||:|||..:...  .|..|...|||.|:.||||...:....|..|::|||||
Mosquito   179 RNDHGIGFDATHFPWLVSVFHEEHAPDSFSLICGASLITPHAVLTAGRCVFNMPKEKLLLRAGEW 243

  Fly    90 DTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSC 154
            .:.....:|:.:..|.:|:::|::|.....||:|||.|...|:.|.|:..|.|....|.|....|
Mosquito   244 TSQDKELRQYQERRVADIMTYEEYNDRTFSNNVALLNLTEPFQRTGNVQPICLPPIPASIDAYRC 308

  Fly   155 F---FN-----GWGKVYLNSTDYPTVLKTVQVDLLSMGMC-SSRKLPIQQICGKGLEGID-CSGD 209
            |   |:     .:|.|.||       :....:.::..|.| .|...|...:|.:|..|.: |...
Mosquito   309 FTVAFDEHLSYKYGSVQLN-------VNMAHIPVMLFGFCRHSGPGPSSYLCARGNLGPNVCRAI 366

  Fly   210 GGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEANFRPR 269
            .|.||||.:...|..|.|.|||:|...........|:.|||....||:..| .|.|.:|:
Mosquito   367 TGTPLVCPMPGSPNHYYQAGIVSWGVGCDTYGVPSVYGNVASFRYWIEQAL-YELNNKPK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 74/231 (32%)
Tryp_SPc 39..256 CDD:214473 72/228 (32%)
CLIPE7XP_001238368.1 Tryp_SPc 185..415 CDD:238113 76/236 (32%)
Tryp_SPc 185..413 CDD:214473 74/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.