DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG11313

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:277 Identity:80/277 - (28%)
Similarity:119/277 - (42%) Gaps:58/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YNQIRRETYGSNPRAT-FPWVVSVLDQR---DWLFRYIGVGSLINPNVVLTAAHILNGTTK---- 79
            ||||   |.|:....| |.|:| :|:.|   ....|....|||||...|:||||.::..|:    
  Fly   113 YNQI---TKGNETVLTEFAWMV-LLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKG 173

  Fly    80 ---YDLVVRAGEWDTSTTAD-------QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMT 134
               :.:.||.||.:||...|       .:.|.:.|..|..||.|......|::||:.|  |.|:.
  Fly   174 DVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRL--AREVA 236

  Fly   135 ANINLIPLYL-QEAGI---QKGSCF-FNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPI- 193
            .:.::.|:.| ...|:   |.|..| ..|||:. |.|...|..:| ::|..:..|:|..:...| 
  Fly   237 YSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRT-LTSESSPVKMK-LRVTYVEPGLCRRKYASIV 299

  Fly   194 ----QQICGKG-LEGIDCSGDGGAPLVCRILTYPYKYAQVGIVN---------WLSQKPVENTFI 244
                ..:|.:| ..|..|.||.|.||:.   .:...:...|||:         |.:         
  Fly   300 VLGDSHLCAEGRSRGDSCDGDSGGPLMA---FHEGVWVLGGIVSFGLNCGSRFWPA--------- 352

  Fly   245 VFTNVAGLLPWIDYHLR 261
            |:|||.....||..::|
  Fly   353 VYTNVLSYETWITQNIR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 72/256 (28%)
Tryp_SPc 39..256 CDD:214473 70/253 (28%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 76/270 (28%)
Tryp_SPc 116..364 CDD:214473 74/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.