DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG9733

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:270 Identity:77/270 - (28%)
Similarity:111/270 - (41%) Gaps:72/270 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIG-------VGSLINPNVVLTAAHILNGTTKYD----LVVRAGEWDTS 92
            |||:| :|:.|    |..|       .|||||...||||||.|.|..:.:    :.||.||.||.
  Fly   173 FPWMV-LLEYR----RRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTR 232

  Fly    93 TTAD-----------QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANI----NLIPL 142
            |..|           .|.:..|.:.:  ||:::. .|.|.:..:.|:   .|..|:    |:.|:
  Fly   233 TAVDCPPGGGSCSPEVQRLGFEEIRV--HERYSE-KASNQVHDIGLI---RMERNVRYSDNIQPI 291

  Fly   143 YL-QEAGI---QKGSCF-FNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR------KLPIQQI 196
            .| ...|:   |.|..| ..|||:....:..  .|.:.|.|:.:....|..|      .|...|:
  Fly   292 CLPSSVGLESRQSGQQFTVAGWGRTLKMARS--AVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQL 354

  Fly   197 CGKGLEGID-CSGDGGAPLVC---------RILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAG 251
            |..|....| |.||.|.||:.         .|:::.||   .|:.:|..         |:||||.
  Fly   355 CAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYK---CGLKDWPG---------VYTNVAA 407

  Fly   252 LLPWIDYHLR 261
            ...||..::|
  Fly   408 YDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 76/266 (29%)
Tryp_SPc 39..256 CDD:214473 74/263 (28%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 74/263 (28%)
Tryp_SPc 162..415 CDD:238113 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.