DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG9737

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:113/282 - (40%) Gaps:68/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QIRRETYGSN--PRATFPWV-VSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLV--- 83
            |:....||..  ....|||: :.|.:..|    |...|:||:...:|||||.:.|....|..   
  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSND----YGCSGALIDDRHILTAAHCVQGEGVRDRQGLK 205

  Fly    84 -VRAGEWDTSTTAD-----------QQHVDLEVLNIVSHEQFNRFN--AENNMALLILVSAFEMT 134
             ||.||::..|..|           ...:|:....|..|.::..|:  ..|::|::.|......|
  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270

  Fly   135 ANINLI-------PLYLQEAGIQKGSCF-FNGWGKV-----YLNSTDYPTVLKTVQVDLLSMGMC 186
            ..:..|       ||.|.|     |..| .:|||:.     |..:...|..|| :::..:|...|
  Fly   271 HFVMPICLPNKSEPLTLAE-----GQMFSVSGWGRTDLFNKYFINIHSPIKLK-LRIPYVSNENC 329

  Fly   187 S------SRKLPIQQICGKGLEGID-CSGDGGAPLV------CRILTY---PYKYAQVGIVNWLS 235
            :      ..:|..:|||..|....| |:||.|.||:      .|.:.|   .|.:.|.|    ::
  Fly   330 TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCG----MA 390

  Fly   236 QKPVENTFIVFTNVAGLLPWID 257
            .||.     |:||||....|||
  Fly   391 GKPA-----VYTNVAEYTDWID 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 73/266 (27%)
Tryp_SPc 39..256 CDD:214473 70/263 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 72/275 (26%)
Tryp_SPc 150..409 CDD:238113 75/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.