DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG11836

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:254 Identity:68/254 - (26%)
Similarity:115/254 - (45%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FNYNQIRRETYGSNPRAT--FPWVVSVLDQRDWLFRYIGV----GSLINPNVVLTAAHILNGTTK 79
            |:..:||  ..|..|...  :||:..::        |.|.    |||:..:.||:|||.:....|
  Fly    90 FSNEEIR--IVGGKPTGVNQYPWMARIV--------YDGKFHCGGSLLTKDYVLSAAHCVKKLRK 144

  Fly    80 YDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANIN--LIPL 142
            ..:.|..|:.|...|::.|.:...|..::.|:.|:.....|::|||.|......:..|.  .:|.
  Fly   145 SKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPR 209

  Fly   143 YLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC-----SSRKLPIQQICGKGLE 202
            |..:...:.|:..  |||:. ....:.|:::..|:|.::|:..|     .|.::....:|. |..
  Fly   210 YNYDPAGRIGTVV--GWGRT-SEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCA-GRP 270

  Fly   203 GID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHL 260
            .:| |.||.|.||   :|:...||..||||:|......|....|::.|:..:|||..:|
  Fly   271 SMDSCQGDSGGPL---LLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/231 (27%)
Tryp_SPc 39..256 CDD:214473 60/228 (26%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.