DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG7432

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:106/246 - (43%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTK-----YDLVVRAGEWDTSTT 94
            |...:||:.::.........:...||||....:|||||....:.:     ....||.|:.|.||.
  Fly   482 PNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTD 546

  Fly    95 AD-QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQK------- 151
            |: ...|...|..:.:||:|:|....|::|:|:|......:..:  ||:.|.: ||:.       
  Fly   547 AEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYV--IPVCLPK-GIRMPPKERLP 608

  Fly   152 -GSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCS-SRKLPIQQ--IC-GKGLEGID-CSGDG 210
             ......|||..|....: .|..:..::.:.....|. |...||.:  || |....|:| |.||.
  Fly   609 GRRATVVGWGTTYYGGKE-STSQRQAELPIWRNEDCDRSYFQPINENFICAGYSDGGVDACQGDS 672

  Fly   211 GAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            |.||:.|   |...:.|:|:|::.::........|:|.|...|.||..|.|
  Fly   673 GGPLMMR---YDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRDHTR 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/238 (27%)
Tryp_SPc 39..256 CDD:214473 62/235 (26%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 63/239 (26%)
Tryp_SPc 475..718 CDD:238113 65/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.