DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG3505

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:109/278 - (39%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRY----------IGVGSLINPNVVLTAAHILNGTTKYDL---VVRAGEWD 90
            |||:.        |..|          .| |.||:...||||||.:......:|   .||.||||
  Fly   118 FPWLA--------LIEYTRGNQEKIHACG-GVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWD 173

  Fly    91 TSTTAD-QQHVDLEVLN------------IVSHEQFNRFNAE--NNMALLILVSAFEMTANI--- 137
            |||..| |.|.|.:|.:            ::.|..:||.:..  |::||:.|.|..::...:   
  Fly   174 TSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPI 238

  Fly   138 ----------NLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC----SS 188
                      .|..|..:.||.|..|                ...::...|.:.|:..|    :|
  Fly   239 CLPNKQLRADELEDLVTEVAGWQASS----------------SQRMRKGYVTISSIEECQRKYAS 287

  Fly   189 RKLPIQ--QICGKGLEGIDCSGDGGAPLVCRILTYPYK---YAQVGIVNWLSQKPVENTF--IVF 246
            ::|.||  ::||. ....:|.|:.|.||:.      :|   |...|:|:: ...|..|..  .|:
  Fly   288 QQLRIQASKLCGL-TNSQECYGNAGGPLML------FKNDGYLLGGLVSF-GPVPCPNPDWPDVY 344

  Fly   247 TNVAGLLPWIDYHLRLEA 264
            |.||..:.||  |..|:|
  Fly   345 TRVASYIDWI--HDSLKA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 70/271 (26%)
Tryp_SPc 39..256 CDD:214473 68/268 (25%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 70/272 (26%)
Tryp_SPc 111..354 CDD:214473 68/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.