DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG9631

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:249 Identity:58/249 - (23%)
Similarity:101/249 - (40%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RATFPWVVSVLDQRDWLFRYIGVG--------SLINPNVVLTAAHILNGTTKYDLVVRAGEWDTS 92
            |..:||:.::         |.|||        |:|:...|:||||.:.|.:...|.|..|..|.:
  Fly   205 RGQYPWLAAL---------YEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLGRHDRN 260

  Fly    93 TTADQQHVDLEVLNIVSHEQFNRFNAENN------MALLILVSAFEMTANINLIPLYLQEAGI-- 149
            ...:.....:.|.::::...:     |.|      :.||:|.|....|..|..:.|:....|:  
  Fly   261 ENPENGASLVSVTSVLTPSAY-----EGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLPP 320

  Fly   150 -QKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRK------LPIQQICGKGLEGI-DC 206
             :..:....|||  |..|.......|||.|.|:....|....      :..:.:|....|.. .|
  Fly   321 NEGDTGAVAGWG--YDRSAQKTRFPKTVSVRLVPRDQCLKEMKRAEDFITRRTVCAGNSESHGPC 383

  Fly   207 SGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVE----NTFIVFTNVAGLLPWI 256
            .||.|:.|:  :|.....|.: |:|: ||.:..|    :.::::.:||..:.|:
  Fly   384 FGDSGSALI--VLRNNRWYVR-GVVS-LSPRHGEICDLSKYVIYCDVARHIDWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 57/246 (23%)
Tryp_SPc 39..256 CDD:214473 56/244 (23%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 58/249 (23%)
Tryp_SPc 198..433 CDD:214473 57/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.