DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG8870

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:287 Identity:87/287 - (30%)
Similarity:122/287 - (42%) Gaps:78/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRETYGSNPRAT-FPWVVSV-------LDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLV 83
            |:.|.|..|... |||:..:       |.|:  |....| |||||...||||||.:    :|..:
  Fly    82 RKPTKGKIPALNEFPWMAMLLYGNKNNLSQK--LVPKCG-GSLINNWYVLTAAHCV----EYPFM 139

  Fly    84 --------VRAGEWDTSTTADQQ-----------HVDLEVLNIVSHEQFNR-FNAENNMALLILV 128
                    ||.||.:|||..|:.           ::::||..|::|||||| ....|::||:.|.
  Fly   140 DYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLK 204

  Fly   129 SAFEMTANINLIPLYL---QEAGIQKGSCFFNGW--------GKVYLNS---TDYPTVLKTVQVD 179
            .....|..|.  |:.|   |:....|.....:||        .:|.|.|   ..:|.|.|: ..|
  Fly   205 FPVRYTRAIQ--PICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKS-NYD 266

  Fly   180 LLSMGMCSSRKLPIQQICGKGLEGIDCS-GDGGAPLVCRI------LTYPYKYAQVGIVNWLSQK 237
             .::|         .|||..||:|.|.| ||.|.||:..:      |||     ..||::: .||
  Fly   267 -FNLG---------SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTY-----AAGIISY-GQK 315

  Fly   238 P-VENTF--IVFTNVAGLLPWIDYHLR 261
            | |..|.  ..:|..:....||...|:
  Fly   316 PCVLKTCKPAFYTKTSYFFEWIKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 82/270 (30%)
Tryp_SPc 39..256 CDD:214473 80/267 (30%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/272 (30%)
Tryp_SPc 93..337 CDD:214473 80/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.