DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG11670

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:232 Identity:59/232 - (25%)
Similarity:94/232 - (40%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSLINPNVVLTAAHIL--NGTTKYDLV----VRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFN 117
            ||||:...||||||.|  :||:. |:|    ::..||:.:....::    .|..|..|..:|...
  Fly   202 GSLISEEFVLTAAHCLTTHGTSP-DIVKIGDIKLKEWELNVAPQRR----RVAQIYLHPLYNASL 261

  Fly   118 AENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDY----PTVLKTVQV 178
            ..:::.|:.|....|.|..:..:.|:... .|..|.....|:|     ||.:    ..:|..:.:
  Fly   262 NYHDIGLIQLNRPVEYTWFVRPVRLWPMN-DIPYGKLHTMGYG-----STGFAQPQTNILTELDL 320

  Fly   179 DLLSMGMCSSRKLP----------IQQICGKGLE--GIDCSGDGGAPLVCRI--------LTYPY 223
            .::.:..|:| .||          ..|||....|  ...|.||.|.||...:        ....|
  Fly   321 SVVPIEQCNS-SLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHY 384

  Fly   224 KYAQVGIVNW----LSQKPVENTFIVFTNVAGLLPWI 256
            :|..|||.::    .|:.|.     |:|.|:..:.||
  Fly   385 RYYLVGITSYGAYCRSELPG-----VYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 59/232 (25%)
Tryp_SPc 39..256 CDD:214473 57/230 (25%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.