DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG11668

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:236 Identity:48/236 - (20%)
Similarity:82/236 - (34%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMAL 124
            ::|.|...:||||..:...:...|...|..:.::...|.   :|:..|..|..|:.....|::|:
  Fly   192 AMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL---IEIKRISQHPHFDAETLTNDLAV 253

  Fly   125 LILVSAFEMTANINLIPLYLQEAGIQKGSCFFN------------GWGKVYLNSTDYPTVLKTV- 176
            :.|.....|..                 :|.:|            |:|:..........:|:.: 
  Fly   254 VKLARRSHMPV-----------------ACLWNQESLPERPLTALGYGQTKFAGPHSSNLLQIML 301

  Fly   177 -------------QVDLLSMGMCSSRKLPIQQICGKGLEG-ID-CSGDGGAPLVC------RILT 220
                         ..|.|:.|:.|.      |:|.....| :| |.||.|.||:.      ...|
  Fly   302 YHLNFQQCQRYLHNYDKLANGLGSG------QMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHT 360

  Fly   221 YPYKYAQVGIVNW----LSQKPVENTFIVFTNVAGLLPWID 257
            .||   .|||.::    .|.:|.     |:..:|..:.||:
  Fly   361 IPY---VVGITSFGGACASGQPG-----VYVRIAHYIQWIE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 48/236 (20%)
Tryp_SPc 39..256 CDD:214473 46/233 (20%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 48/236 (20%)
Tryp_SPc 149..392 CDD:214473 46/233 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.