DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG10041

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:271 Identity:61/271 - (22%)
Similarity:106/271 - (39%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLVNSQYFNYNQIRRETYGSNP-------------------RATFPWVVSVLDQRDWLFRYIGVG 59
            ||.:..:|......:||....|                   |..:|::||:.:.....::::.||
  Fly     6 SLCSIAWFAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHLCVG 70

  Fly    60 SLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMAL 124
            .:::...||:|||.:.......|.| ||..|:..:..|..  ..|:....|.|| |....|::|:
  Fly    71 VILSNEFVLSAAHCIQTNPTKQLYV-AGGADSLNSRKQTR--FFVVERRWHPQF-RVLGGNDIAV 131

  Fly   125 LILVSAFEMT----ANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSM-- 183
            |.:...|.:.    .:||......:::|.|..   ..|||:|.:..     :.|..::..|:|  
  Fly   132 LRIYPKFPLDDVRFRSINFAGKPQRDSGTQAS---LVGWGRVGVGK-----IRKLQEMPFLTMEN 188

  Fly   184 GMCSSRK----LPIQQICGKGLEGI--DCSGDGGAPL-------VCRILTY---------PYKYA 226
            ..|....    |....||...|:|.  .|.||.||||       :..:|:|         ||.:.
  Fly   189 DECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKPYAFT 253

  Fly   227 QVGIV-NWLSQ 236
            ::... :|:.:
  Fly   254 RINAYSSWIQE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 54/227 (24%)
Tryp_SPc 39..256 CDD:214473 54/227 (24%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 54/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.