DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG16749

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:125/277 - (45%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAFLTTLIISLVNSQYFNYNQIRRETYGSNPRA-TFPWVVSVLDQRDWLFRYIGVGSLINPNVVL 68
            ||.|||..||      ....|:.|...|::... .:|:|:|:   |.....:...||:|:...|:
  Fly    12 FALLTTAGIS------HGAPQMGRVVNGTDSSVEKYPFVISM---RGSSGSHSCGGSIISKQFVM 67

  Fly    69 TAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRF-NAENNMALLILVSAFE 132
            ||||..:|....||.|:.|.  |...|...:| :.|..|:.||.:|.: |..|:::||::...||
  Fly    68 TAAHCTDGRKASDLSVQYGV--TKINATGPNV-VRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129

  Fly   133 MTANINLIPLYLQE---------AGIQKGSCFFNGWGKVYLNSTD--YPTVLKTVQVDLLSMGMC 186
            .. .:.:.|:.|.|         ||   |.....|||   ||:|.  ..:.|:.|::.:.|...|
  Fly   130 FD-GVTVAPVKLPELAFATPQTDAG---GEGVLIGWG---LNATGGYIQSTLQEVELKVYSDEEC 187

  Fly   187 S----SRKLPIQQICGKGLEGID------CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKP--V 239
            :    .|..|...|||    |:|      ||||.|.||:       |...|||||:| |.||  |
  Fly   188 TERHGGRTDPRYHICG----GVDEGGKGQCSGDSGGPLI-------YNGQQVGIVSW-SIKPCTV 240

  Fly   240 ENTFIVFTNVAGLLPWI 256
            .....|:..|:..:.||
  Fly   241 APYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 76/242 (31%)
Tryp_SPc 39..256 CDD:214473 74/240 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/252 (30%)
Tryp_SPc 30..259 CDD:238113 77/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.