DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Sp7

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:270 Identity:69/270 - (25%)
Similarity:106/270 - (39%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETYGSNPRATFPWVVSVLDQRDW--LFRYIG---------VGSLINPNVVLTAAHILNGTTKYDL 82
            :.|..|..|        :|:.:|  |..|:.         .|||||...||||||.:.|..:.::
  Fly   136 KVYNGNDTA--------IDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEV 192

  Fly    83 ----VVRAGEWDTSTTAD-------QQHVDLEVLNIVSHEQFNRFNAE--NNMALLILVSAFEMT 134
                .||.||:|||...|       |..:.|.:.....|.|::..|..  :::|||.|.....:.
  Fly   193 GHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLN 257

  Fly   135 ANIN--LIPLYLQEAGIQKGSCF-FNGWGK--------------VYLNSTDY-PTVLKTVQVDLL 181
            ..|.  .:||......|..|... .:|||:              :.:|..|| .....|..:.|:
  Fly   258 EYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYCARKFATRNIHLI 322

  Fly   182 SMGMCSSRKLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVF 246
            |..:|          .|.......|.||.|.||:.|  .:...:.|.|:|::.::..:|....|:
  Fly   323 SSQLC----------VGGEFYRDSCDGDSGGPLMRR--GFDQAWYQEGVVSFGNRCGLEGWPGVY 375

  Fly   247 TNVAGLLPWI 256
            |.||..:.||
  Fly   376 TRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 66/260 (25%)
Tryp_SPc 39..256 CDD:214473 64/258 (25%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 67/268 (25%)
Tryp_SPc 137..388 CDD:238113 69/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.